PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast04G158600.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 334aa    MW: 36166.7 Da    PI: 6.9059
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast04G158600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.53e-54131401129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeelv++yL++k+++    +++++ e+d++k+ePwdLp++++ +ekewyfF+ +d+ky+tg+r+nrat+sgyWkatgkd+e
  Brast04G158600.2.p  13 LPPGFRFHPTDEELVTHYLARKTADPAGFAARAVGEADLNKCEPWDLPSRATMGEKEWYFFVVKDRKYPTGTRTNRATESGYWKATGKDRE 103
                         79*********************9999666689***************988899************************************* PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         +l+ +++lvg+kktLvfy+grapkg kt Wvmheyrle
  Brast04G158600.2.p 104 ILR-GKALVGMKKTLVFYTGRAPKGGKTGWVMHEYRLE 140
                         **9.99******************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-637168IPR003441NAC domain
PROSITE profilePS5100559.92713168IPR003441NAC domain
PfamPF023653.5E-2914139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MEHDVHQQEP MELPPGFRFH PTDEELVTHY LARKTADPAG FAARAVGEAD LNKCEPWDLP  60
SRATMGEKEW YFFVVKDRKY PTGTRTNRAT ESGYWKATGK DREILRGKAL VGMKKTLVFY  120
TGRAPKGGKT GWVMHEYRLE GKHAPAPYSL PRAATSKDEW VLCRVFKKSL EPSVAGNNGA  180
RKGACTGNMA DAVGSSMSLA DASCALPPLM DVAASSGFFA PPAAAHVTCF SNALEGHQFL  240
NPPFLLPASS AALQGAGDNM HIAMESAASP FFASMYAQEL LLDGGGGGWY SKGERERLSG  300
ASQDTGLTSE VNPTEISSSR QQHMDHEPAF WGY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-551116915166NO APICAL MERISTEM PROTEIN
1ut4_B5e-551116915166NO APICAL MERISTEM PROTEIN
1ut7_A5e-551116915166NO APICAL MERISTEM PROTEIN
1ut7_B5e-551116915166NO APICAL MERISTEM PROTEIN
3swm_A6e-551116918169NAC domain-containing protein 19
3swm_B6e-551116918169NAC domain-containing protein 19
3swm_C6e-551116918169NAC domain-containing protein 19
3swm_D6e-551116918169NAC domain-containing protein 19
3swp_A6e-551116918169NAC domain-containing protein 19
3swp_B6e-551116918169NAC domain-containing protein 19
3swp_C6e-551116918169NAC domain-containing protein 19
3swp_D6e-551116918169NAC domain-containing protein 19
4dul_A5e-551116915166NAC domain-containing protein 19
4dul_B5e-551116915166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0952991e-165FP095299.1 Phyllostachys edulis cDNA clone: bphylf045c18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235594.10.0PREDICTED: NAC domain-containing protein 92-like isoform X2
SwissprotQ9FLJ23e-85NC100_ARATH; NAC domain-containing protein 100
TrEMBLI1IAW80.0I1IAW8_BRADI; Uncharacterized protein
STRINGBRADI3G46900.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-85NAC domain containing protein 100